Camel LDAP

Tagsbeansrepositoryintegrationscmbuildbuild-systemredhatmavengitapacheldapplatformscriptingpatchdirectorycamel
Ranking#743715 in MvnRepository (See Top Artifacts)

VersionVulnerabilitiesRepositoryUsagesDate
2.21.x
2.21.0.fuse-760027-redhat...Redhat EA
0
Feb 13, 2022

Related Books

Apache Camel For Beginners : Step-by-Step Instructional Handbook on Apache Camel for First-Time IntegratorsApache Camel For Beginners : Step-by-Step Instructional Handbook on Apache Camel for First-Time Integrators (2025)
by PANCHTILAK, NARENDRA
LDAP: The Directory Protocol in ActionLDAP: The Directory Protocol in Action (2025)
by Relington, James
The Apache Maven Handbook: Practical Solutions for Build and DeploymentThe Apache Maven Handbook: Practical Solutions for Build and Deployment (2025)
by Johnson, Robert
Advanced Apache Camel: Integration Patterns for Complex SystemsAdvanced Apache Camel: Integration Patterns for Complex Systems (2024)
by Jones, Peter
Ultimate Git and GitHub for Modern Software Development: Unlock the Power of Git and GitHub Version Control and Collaborative Coding to Seamlessly ... Software Projects (English Edition)Ultimate Git and GitHub for Modern Software Development: Unlock the Power of Git and GitHub Version Control and Collaborative Coding to Seamlessly ... Software Projects (English Edition) (2024)
by Mishra, Pravin
Mastering Apache MavenMastering Apache Maven (2024)
by Hadzic, Rijad
Write efficient unit tests with Apache CamelWrite efficient unit tests with Apache Camel (2024)
by Moraes, Jonathan
Implementation of the LDAP protocol in the establishment of a domainImplementation of the LDAP protocol in the establishment of a domain (2023)
by Bastidas Logroño, Diego Javier
Learning Git: A Hands-On and Visual Guide to the Basics of GitLearning Git: A Hands-On and Visual Guide to the Basics of Git (2023)
by Skoulikari, Anna
Version Control with Git: Powerful Tools and Techniques for Collaborative Software DevelopmentVersion Control with Git: Powerful Tools and Techniques for Collaborative Software Development (2022)
by Ponuthorai, Prem Kumar, Loeliger, Jon
Git: Project Management for Developers and DevOps - A Hands-on Guide to Version Control, Workflow Management, and Using GitHub, GitLab, and Alternative Git Platforms (Rheinwerk Computing)Git: Project Management for Developers and DevOps - A Hands-on Guide to Version Control, Workflow Management, and Using GitHub, GitLab, and Alternative Git Platforms (Rheinwerk Computing) (2022)
by Bernd Öggl, Michael Kofler
Head First Git: A Learner's Guide to Understanding Git from the Inside OutHead First Git: A Learner's Guide to Understanding Git from the Inside Out (2022)
by Gandhi, Raju
Cloud Native Integration with Apache Camel: Building Agile and Scalable Integrations for Kubernetes PlatformsCloud Native Integration with Apache Camel: Building Agile and Scalable Integrations for Kubernetes Platforms (2021)
by Camposo, Guilherme
Cloud Native Integration with Apache Camel: Building Agile and Scalable Integrations for Kubernetes PlatformsCloud Native Integration with Apache Camel: Building Agile and Scalable Integrations for Kubernetes Platforms (2021)
by Camposo, Guilherme
Apache Camel EssentialsApache Camel Essentials (2020)
by Prajod Surendran V, Gnanaguru Sattanathan, Naveen Raj
Introducing Maven: A Build Tool for Today's Java DevelopersIntroducing Maven: A Build Tool for Today's Java Developers (2019)
by Varanasi, Balaji
Camel in ActionCamel in Action (2018)
by Ibsen, Claus, Anstey, Jonathan
Maven: The Definitive GuideMaven: The Definitive Guide (2015)
by Jackson, Brian
Maven Essentials: Get started with the essentials of Apache Maven and get your build automation system up and running quicklyMaven Essentials: Get started with the essentials of Apache Maven and get your build automation system up and running quickly (2015)
by Siriwardena, Prabath
Mastering Apache CamelMastering Apache Camel (2015)
by Onofre, Jean-Baptiste
Mastering Apache CamelMastering Apache Camel (2015)
by Onofré, Jean-Baptiste
Apache Maven CookbookApache Maven Cookbook (2015)
by Bharathan, Raghuram
Catching up with Apache Camel (Korean Edition)Catching up with Apache Camel (Korean Edition) (2015)
by Scott Cranton
Mastering Apache Maven 3Mastering Apache Maven 3 (2014)
by Siriwardena, Prabath
Introducing MavenIntroducing Maven (2014)
by Varanasi, Balaji, Belida, Sudha
Pro GitPro Git (2014)
by Chacon, Scott, Straub, Ben
Apache Camel Developer's Cookbook (Solve Common Integration Tasks With over 100 Easily Accessible Apache Camel Recipes)Apache Camel Developer's Cookbook (Solve Common Integration Tasks With over 100 Easily Accessible Apache Camel Recipes) (2013)
by Cranton, Scott, Korab, Jakub
Apache Camel Developer's Cookbook (Solve Common Integration Tasks With over 100 Easily Accessible Apache Camel Recipes)Apache Camel Developer's Cookbook (Solve Common Integration Tasks With over 100 Easily Accessible Apache Camel Recipes) (2013)
by Cranton, Scott, Korab, Jakub
Apache Maven Dependency ManagementApache Maven Dependency Management (2013)
by Lalou, Jonathan
Instant Apache Camel Messaging SystemInstant Apache Camel Messaging System (2013)
by Sharapov, Evgeniy
Instant Apache Camel Message RoutingInstant Apache Camel Message Routing (2013)
by Ibryam, Bilgin
Instant Apache Camel Message RoutingInstant Apache Camel Message Routing (2013)
by Ibryam, Bilgin
Instant Apache Maven StarterInstant Apache Maven Starter (2013)
by Turatti, Maurizio, Pillitu, Maurizio
Apache Maven 3 CookbookApache Maven 3 Cookbook (2011)
by Srirangan
Apache Maven 2 Effective ImplementationApache Maven 2 Effective Implementation (2009)
by Porter, Brett, Ching, Maria Odea
Maven: The Definitive GuideMaven: The Definitive Guide (2008)
by Company, Sonatype
Maven: A Developer's NotebookMaven: A Developer's Notebook (2005)
by Massol, Vincent, O'Brien, Timothy M.
Deploying OpenLDAPDeploying OpenLDAP (2004)
by Jackiewicz, Tom
LDAP DirectoriesLDAP Directories (2003)
by Rizcallah, Marcel
Understanding and Deploying LDAP Directory Services, 2nd EditionUnderstanding and Deploying LDAP Directory Services, 2nd Edition (2003)
by Howes, Tim, Smith, Mark, Good, Gordon S.
Camel in Action +EbookCamel in Action +Ebook
by Ibsen, Claus, Anstey, Jonathan, Hohpe, Gregor, Strachan, James